diff options
Diffstat (limited to 'Master')
| -rw-r--r-- | Master/texmf-dist/doc/latex/seqsplit/README | 18 | ||||
| -rw-r--r-- | Master/texmf-dist/doc/latex/seqsplit/seqsplit.pdf | bin | 0 -> 127960 bytes | |||
| -rw-r--r-- | Master/texmf-dist/source/latex/seqsplit/Makefile | 47 | ||||
| -rw-r--r-- | Master/texmf-dist/source/latex/seqsplit/seqsplit.dtx | 424 | ||||
| -rw-r--r-- | Master/texmf-dist/source/latex/seqsplit/seqsplit.ins | 29 | ||||
| -rw-r--r-- | Master/texmf-dist/tex/latex/seqsplit/seqsplit.sty | 41 | ||||
| -rw-r--r-- | Master/texmf-dist/tpm/seqsplit.tpm | 30 | ||||
| -rw-r--r-- | Master/texmf/lists/seqsplit | 9 | ||||
| -rw-r--r-- | Master/texmf/tpm/collection-latexextra.tpm | 1 |
9 files changed, 599 insertions, 0 deletions
diff --git a/Master/texmf-dist/doc/latex/seqsplit/README b/Master/texmf-dist/doc/latex/seqsplit/README new file mode 100644 index 00000000000..1a1939c648c --- /dev/null +++ b/Master/texmf-dist/doc/latex/seqsplit/README @@ -0,0 +1,18 @@ + Splitting Long Sequences of Letters (DNA, RNA, Proteins, Etc.) + Boris Veytsman + Version 0.1, August 7, 2006 + +Sometimes one needs to typeset long sentences of letters, which should +not have spaces between them (like letters in words), but could be +split between lines at any point, often without a hyphenation +character. This problem was formulated at the PracticalTeX-2006 +conference by Klaus Hoeppner. In the general discussion several +solutions were suggested. This package implements the one belonging +to, I believe, Peter Flynn. + + +Copyright 2006, Boris Veytsman <borisv@lk.net> + +This work may be distributed and/or modified under the conditions of +the LaTeX Project Public License, either version 1.3 of this license +or (at your option) any later version. diff --git a/Master/texmf-dist/doc/latex/seqsplit/seqsplit.pdf b/Master/texmf-dist/doc/latex/seqsplit/seqsplit.pdf Binary files differnew file mode 100644 index 00000000000..014a11d0d75 --- /dev/null +++ b/Master/texmf-dist/doc/latex/seqsplit/seqsplit.pdf diff --git a/Master/texmf-dist/source/latex/seqsplit/Makefile b/Master/texmf-dist/source/latex/seqsplit/Makefile new file mode 100644 index 00000000000..b98979e03f0 --- /dev/null +++ b/Master/texmf-dist/source/latex/seqsplit/Makefile @@ -0,0 +1,47 @@ +# +# Makefile for seqsplit package +# +# This file is in public domain +# +# $Id: Makefile,v 1.1 2006/08/07 22:00:19 boris Exp $ +# + +PACKAGE=seqsplit + +all: $(PACKAGE).pdf + + +%.pdf: %.dtx $(PACKAGE).sty + pdflatex $< + - bibtex $* + pdflatex $< + - makeindex -s gind.ist -o $*.ind $*.idx + - makeindex -s gglo.ist -o $*.gls $*.glo + pdflatex $< + while ( grep -q '^LaTeX Warning: Label(s) may have changed' $*.log) \ + do pdflatex $<; done + + +%.sty: %.ins %.dtx + pdflatex $< + + + +.PRECIOUS: $(PACKAGE).cfg $(PACKAGE).sty + + +clean: + $(RM) $(PACKAGE).sty $(PACKAGE).log $(PACKAGE).aux \ + $(PACKAGE).cfg $(PACKAGE).glo $(PACKAGE).idx $(PACKAGE).toc \ + $(PACKAGE).ilg $(PACKAGE).ind $(PACKAGE).out $(PACKAGE).lof \ + $(PACKAGE).lot $(PACKAGE).bbl $(PACKAGE).blg $(PACKAGE).gls \ + $(PACKAGE).dvi $(PACKAGE).ps + +veryclean: clean + $(RM) $(PACKAGE).pdf + +# +# Archive for the distribution. Includes typeset documentation +# +archive: all clean + tar -czvf $(PACKAGE).tgz --exclude '*~' --exclude '*.tgz' --exclude CVS . diff --git a/Master/texmf-dist/source/latex/seqsplit/seqsplit.dtx b/Master/texmf-dist/source/latex/seqsplit/seqsplit.dtx new file mode 100644 index 00000000000..7c5b6874db4 --- /dev/null +++ b/Master/texmf-dist/source/latex/seqsplit/seqsplit.dtx @@ -0,0 +1,424 @@ +% \iffalse +%<*gobble> +% $Id: seqsplit.dtx,v 1.3 2006/08/08 00:02:08 boris Exp $ +% +% Copyright 2006, Boris Veytsman <borisv@lk.net> +% This work may be distributed and/or modified under the +% conditions of the LaTeX Project Public License, either +% version 1.3 of this license or (at your option) any +% later version. +% The latest version of the license is in +% http://www.latex-project.org/lppl.txt +% and version 1.3 or later is part of all distributions of +% LaTeX version 2003/06/01 or later. +% +% This work has the LPPL maintenance status `maintained'. +% +% The Current Maintainer of this work is Boris Veytsman +% +% This work consists of the file seqsplit.dtx and the +% derived files seqsplit.sty, seqsplit.dtx. +% +% \fi +% \CheckSum{50} +% +% \changes{v0.1}{2006/08/07}{The first released version} +% +%% \CharacterTable +%% {Upper-case \A\B\C\D\E\F\G\H\I\J\K\L\M\N\O\P\Q\R\S\T\U\V\W\X\Y\Z +%% Lower-case \a\b\c\d\e\f\g\h\i\j\k\l\m\n\o\p\q\r\s\t\u\v\w\x\y\z +%% Digits \0\1\2\3\4\5\6\7\8\9 +%% Exclamation \! Double quote \" Hash (number) \# +%% Dollar \$ Percent \% Ampersand \& +%% Acute accent \' Left paren \( Right paren \) +%% Asterisk \* Plus \+ Comma \, +%% Minus \- Point \. Solidus \/ +%% Colon \: Semicolon \; Less than \< +%% Equals \= Greater than \> Question mark \? +%% Commercial at \@ Left bracket \[ Backslash \\ +%% Right bracket \] Circumflex \^ Underscore \_ +%% Grave accent \` Left brace \{ Vertical bar \| +%% Right brace \} Tilde \~} +% +%\iffalse +% \begin{macrocode} +\documentclass{ltxdoc} +\usepackage{array} +\usepackage{url} +\usepackage{seqsplit} +\DoNotIndex{\NeedsTeXFormat, \ProvidesPackage, \def, \hspace} +\DoNotIndex{\futurelet, \@gobble, \ifx, \else, \fi, \relax} +\DoNotIndex{\ifmmode, \fi, \allowbreak} +\PageIndex +\CodelineIndex +\RecordChanges +\EnableCrossrefs +\begin{document} + \DocInput{seqsplit.dtx} +\end{document} +% \end{macrocode} +%</gobble> +% \fi +% \MakeShortVerb{|} +% +%\GetFileInfo{seqsplit.sty} +% \title{Splitting Long Sequences of Letters (DNA, RNA, Proteins, +% Etc.)\thanks{\copyright Boris Veytsman, 2006}} +% \author{Boris Veytsman} +% \date{\filedate, \fileversion} +% \maketitle +% +% \begin{abstract} +% Sometimes one needs to typeset long sentences of letters, which +% should not have spaces between them (like letters in words), but +% could be split between lines at any point, and without a +% hyphenation character. This package provides a command for such +% sequences. +% \end{abstract} +% +% \tableofcontents +% +% \clearpage +% +%\section{Introduction} +%\label{sec:intro} +% +% At a recent Practical\TeX{} conference (Practical\TeX-2006, Rutgers, +% New Jersey, USA, \url{http://www.tug.org/practicaltex2006}) Klaus +% H\"oppner asked, how one typesets long sequences like the ones +% related to DNA code. Usually there is no space between letters, but +% a sequence could be split at any point and continued on the next +% line. The audience suggested several solutions to this problem. +% One solution, for example, was to define a new language, where +% hyphenation is possible at any point, and hyphenation character is +% empty. However, this would require regeneration of all \TeX{} +% formats, which might be not practical or even not possible. Another +% solution, suggested, if my memory is right, by Peter Flynn, was to +% scan the sequence and insert a breaking point after each letter. +% This later approach is implemented in this package. +% +% +% +%\section{User Interface} +%\label{sec:interface} +% +% +%\subsection{Main Command} +%\label{sec:command} +% +% \DescribeMacro{\seqsplit} +% The main (and actually the only) command in this package is +% |\seqsplit|. Its usage is very simple, for example to typeset the +% gene HBB, related to sickle cell anaemia (actually, the +% corresponding mRNA Reference Sequence), we use the following: +% \begin{verbatim} +% \seqsplit{% +% acatttgcttctgacacaactgtgttcactagcaacctcaaacagacaccatggtgcatc% +% tgactcctgaggagaagtctgccgttactgccctgtggggcaaggtgaacgtggatgaag% +% ttggtggtgaggccctgggcaggctgctggtggtctacccttggacccagaggttctttg% +% agtcctttggggatctgtccactcctgatgctgttatgggcaaccctaaggtgaaggctc% +% atggcaagaaagtgctcggtgcctttagtgatggcctggctcacctggacaacctcaagg% +% gcacctttgccacactgagtgagctgcactgtgacaagctgcacgtggatcctgagaact% +% tcaggctcctgggcaacgtgctggtctgtgtgctggcccatcactttggcaaagaattca% +% ccccaccagtgcaggctgcctatcagaaagtggtggctggtgtggctaatgccctggccc% +% acaagtatcactaagctcgctttcttgctgtccaatttctattaaaggttcctttgttcc% +% ctaagtccaactactaaactgggggatattatgaagggccttgagcatctggattctgcc% +% taataaaaaacatttattttcattgc}. +% \end{verbatim} +% which produces +% \begin{quote} +% \seqsplit{% +% acatttgcttctgacacaactgtgttcactagcaacctcaaacagacaccatggtgcatc% +% tgactcctgaggagaagtctgccgttactgccctgtggggcaaggtgaacgtggatgaag% +% ttggtggtgaggccctgggcaggctgctggtggtctacccttggacccagaggttctttg% +% agtcctttggggatctgtccactcctgatgctgttatgggcaaccctaaggtgaaggctc% +% atggcaagaaagtgctcggtgcctttagtgatggcctggctcacctggacaacctcaagg% +% gcacctttgccacactgagtgagctgcactgtgacaagctgcacgtggatcctgagaact% +% tcaggctcctgggcaacgtgctggtctgtgtgctggcccatcactttggcaaagaattca% +% ccccaccagtgcaggctgcctatcagaaagtggtggctggtgtggctaatgccctggccc% +% acaagtatcactaagctcgctttcttgctgtccaatttctattaaaggttcctttgttcc% +% ctaagtccaactactaaactgggggatattatgaagggccttgagcatctggattctgcc% +% taataaaaaacatttattttcattgc}. +% \end{quote} +% Note that the breaking points in the code (commented out by \%) have +% nothing to do with the breaking points in the typeset sequence and +% are introduced only for readability of the code. +% +% The corresponding protein sequence ($\beta$-globulin) is shorter: +% \begin{verbatim} +% \seqsplit{% +% mvhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpk% +% vkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfg% +% keftppvqaayqkvvagvanalahkyh}. +% \end{verbatim} +% \begin{quote} +% \seqsplit{% +% mvhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpk% +% vkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfg% +% keftppvqaayqkvvagvanalahkyh}. +% \end{quote} +% +% The command works in math mode as well: +% \begin{verbatim} +% $\pi = \seqsplit{% +% 3. +% 1415926535 8979323846 2643383279 5028841971 6939937510 +% 5820974944 5923078164 0628620899 8628034825 3421170679 +% 8214808651 3282306647 0938446095 5058223172 5359408128 +% 4811174502 8410270193 8521105559 6446229489 5493038196 +% 4428810975 6659334461 2847564823 3786783165 2712019091 +% 4564856692 3460348610 4543266482 1339360726 0249141273 +% 7245870066 0631558817 4881520920 9628292540 9171536436 +% 7892590360 0113305305 4882046652 1384146951 9415116094 +% 3305727036 5759591953 0921861173 8193261179 3105118548 +% 0744623799 6274956735 1885752724 8912279381 8301194912 +% 9833673362 4406566430 8602139494 6395224737 1907021798 +% 6094370277 0539217176 2931767523 8467481846 7669405132 +% 0005681271 4526356082 7785771342 7577896091 7363717872 +% 1468440901 2249534301 4654958537 1050792279 6892589235} +% \ldots$ +% \end{verbatim} +% \begin{quote} +% $\pi = \seqsplit{% +% 3. +% 1415926535 8979323846 2643383279 5028841971 6939937510 +% 5820974944 5923078164 0628620899 8628034825 3421170679 +% 8214808651 3282306647 0938446095 5058223172 5359408128 +% 4811174502 8410270193 8521105559 6446229489 5493038196 +% 4428810975 6659334461 2847564823 3786783165 2712019091 +% 4564856692 3460348610 4543266482 1339360726 0249141273 +% 7245870066 0631558817 4881520920 9628292540 9171536436 +% 7892590360 0113305305 4882046652 1384146951 9415116094 +% 3305727036 5759591953 0921861173 8193261179 3105118548 +% 0744623799 6274956735 1885752724 8912279381 8301194912 +% 9833673362 4406566430 8602139494 6395224737 1907021798 +% 6094370277 0539217176 2931767523 8467481846 7669405132 +% 0005681271 4526356082 7785771342 7577896091 7363717872 +% 1468440901 2249534301 4654958537 1050792279 6892589235} +% \ldots$ +% \end{quote} +% +%\subsection{Customization} +%\label{sec:customization} +% +% \DescribeMacro{\seqinsert} The command |\seqsplit| can be customized +% by redefining the command |\seqinsert|, which is the macro that is +% inserted between the letters of the sequence. By default it is +% defined as |\allowbreak| in math mode and |\hspace{0pt plus 0.02em}| +% in text mode: a slightly stretchable glue of zero length. This +% definition gives \TeX{} a chance to justify the lines. However, +% there might be other definitions. For example, if we want hyphens +% at the breakpoints in text mode, we can use: +% \begin{quote} +% |\renewcommand{\seqinsert}{\ifmmode\allowbreak\else\-\fi}| +% \end{quote} +% which produces for the $\beta$-globulin protein from the previous +% section the following: +% \begin{quote} +% \renewcommand{\seqinsert}{\ifmmode\allowbreak\else\-\fi} +% \seqsplit{% +% mvhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpk% +% vkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfg% +% keftppvqaayqkvvagvanalahkyh}. +% \end{quote} +% Another redefinition, +% \begin{quote} +% |\renewcommand{\seqinsert}{\ifmmode\allowbreak\else{} \fi}|, +% \end{quote} +% produces an output with spaces between letters. Note that there is +% no space between the last letter and the dot: the package takes care +% of this: +% \begin{quote} +% \renewcommand{\seqinsert}{\ifmmode\allowbreak\else{} \fi} +% \seqsplit{% +% mvhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpk% +% vkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfg% +% keftppvqaayqkvvagvanalahkyh}. +% \end{quote} +% +% +% +%\subsection{Grouping and Commands} +%\label{sec:grouping} +% +% The command |\seqsplit| does not insert breakpoints between the +% letters inside braces |{...}|. Compare the typesetting of +% $\beta$-globulin in Section~\ref{sec:command} and the following +% example: +% \begin{verbatim} +% \seqsplit{% +% mvhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpk% +% v{kahg}kkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfg% +% keftppvqaayqkvvagvanalahkyh}. +% \end{verbatim} +% \begin{quote} +% \seqsplit{% +% mvhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpk% +% v{kahg}kkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfg% +% keftppvqaayqkvvagvanalahkyh}. +% \end{quote} +% The braces around |{kahg}| prevented a splitting of this group. +% This effect can be used for typesetting special substrings inside +% sequences. +% +% The way |\seqsplit| works interferes with formatting commands like +% |\textit|. Therefore the sequence |{kahg}| is \emph{not} italicized +% in the following example: +% \begin{verbatim} +% \seqsplit{% +% mvhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpk% +% v\textit{kahg}kkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvl% +% vcvlahhfgkeftppvqaayqkvvagvanalahkyh}. +% \end{verbatim} +% \begin{quote} +% \seqsplit{% +% mvhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpk% +% v\textit{kahg}kkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvl% +% vcvlahhfgkeftppvqaayqkvvagvanalahkyh}. +% \end{quote} +% +% Using grouping |{\textit{kahg}}| we can save the situation: +% \begin{verbatim} +% \seqsplit{% +% mvhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpk% +% v{\textit{kahg}}kkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvl% +% vcvlahhfgkeftppvqaayqkvvagvanalahkyh}. +% \end{verbatim} +% \begin{quote} +% \seqsplit{% +% mvhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpk% +% v{\textit{kahg}}kkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvl% +% vcvlahhfgkeftppvqaayqkvvagvanalahkyh}. +% \end{quote} +% +% If we want the italicized sequence to be splittable as well, we can +% use \emph{nested} |\seqsplit|: +% \begin{verbatim} +% \seqsplit{% +% mvhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpk% +% v{\textit{\seqsplit{kahg}}}kkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvl% +% vcvlahhfgkeftppvqaayqkvvagvanalahkyh}. +% \end{verbatim} +% \begin{quote} +% \seqsplit{% +% mvhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpk% +% v{\textit{\seqsplit{kahg}}}kkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvl% +% vcvlahhfgkeftppvqaayqkvvagvanalahkyh}. +% \end{quote} +% +% These tricks allow one to produce splittable sequences with a rather +% complex formatting. +% +% +%\StopEventually{} +% +% \clearpage +% +% \section{Implementation} +% \label{sec:implementation} +% +% +%\subsection{Declarations} +%\label{sec:decl} +% +% We start with declaration, who we are: +% +% +% \begin{macrocode} +%<*style> +\NeedsTeXFormat{LaTeX2e} +\ProvidesPackage{seqsplit} +[2006/08/07 v0.1 Splitting long sequences (DNA, RNA, proteins, etc.) ] +% \end{macrocode} +% +% +% +% +%\subsection{Inserted Text} +%\label{sec:insertion} +% +% +% \begin{macro}{\seqinsert} +% This is the macro we insert between letters: +% \begin{macrocode} +\def\seqinsert{\ifmmode\allowbreak\else\hspace{0pt plus 0.02em}\fi} +% \end{macrocode} +% \end{macro} +% +% +% +%\subsection{Scanner} +%\label{sec:scanner} +% +% The scanner code is not too trivial. Here we describe it in detail. +% +% \begin{macro}{\seqsplit} +% The main (actually, the only) user-space macro just starts the +% scanner. +% \begin{macrocode} +\def\seqsplit#1{\SQSPL@scan#1\SQSPL@end} +% \end{macrocode} +% \end{macro} +% +% The macro |\SQSPL@end| is never expanded, it is just a marker. +% \begin{macro}{\SQSPL@scan} +% The macro |\SQSPL@scan| saves the next token in the special +% register |\SQSPL@next|, so we can decide what to do with it: +% \begin{macrocode} +\def\SQSPL@scan{\futurelet\SQSPL@next\SQSPL@scani} +% \end{macrocode} +% \end{macro} +% \begin{macro}{\SQSPL@scani} +% Now since we know the next token, we can decide to either stop the +% expansion if we met the end, or continue it if we did not. +% \begin{macrocode} +\def\SQSPL@scani#1{% + \ifx \SQSPL@end \SQSPL@next \def\SQSPL@process{\@gobble}% + \else \def\SQSPL@process{\SQSPL@doprocess}\fi% + \SQSPL@process{#1}} +% \end{macrocode} +% \end{macro} +% \begin{macro}{\SQSPL@doprocess} +% The processing of a letter depends on what is the next letter. If +% the sequence is finished, we should not insert anything after the +% last letter: we do not want to break the line between the sequence +% and, say, a comma. Therefore we insert a special smart macro: +% \begin{macrocode} +\def\SQSPL@doprocess#1{#1\SQSPL@insert} +% \end{macrocode} +% \end{macro} +% \begin{macro}{\SQSPL@insert} +% The macro |\SQSPL@insert| uses |\futurelet| to check whether the +% processed letter is the last one in the sentence: +% \begin{macrocode} +\def\SQSPL@insert{\futurelet\SQSPL@next\SQSPL@doinsert} +% \end{macrocode} +% \end{macro} +% \begin{macro}{\SQSPL@doinsert} +% And this is the macro that inserts |\seqinsert| and continues +% scanning: +% \begin{macrocode} +\def\SQSPL@doinsert{% + \ifx \SQSPL@end \SQSPL@next \relax% + \else \seqinsert \fi% + \SQSPL@scan} +% \end{macrocode} +% \end{macro} +% +% +%\subsection{The Last Words} +%\label{sec:last} +% +% +% +% \begin{macrocode} +%</style> +% \end{macrocode} +%\Finale +%\clearpage +% +%\PrintChanges +%\clearpage +%\PrintIndex +% +\endinput diff --git a/Master/texmf-dist/source/latex/seqsplit/seqsplit.ins b/Master/texmf-dist/source/latex/seqsplit/seqsplit.ins new file mode 100644 index 00000000000..bd453b4fcc8 --- /dev/null +++ b/Master/texmf-dist/source/latex/seqsplit/seqsplit.ins @@ -0,0 +1,29 @@ +% +% Doctrip file for seqsplit +% This file is in public domain +% $Id: seqsplit.ins,v 1.1 2006/08/07 22:00:19 boris Exp $ +% +\def\batchfile{seqsplit.ins} +\input docstrip +\keepsilent +\showprogress + + +\askforoverwritefalse + +\generate{% + \file{seqsplit.sty}{\from{seqsplit.dtx}{style}}} + +\obeyspaces +\Msg{*****************************************************}% +\Msg{* Congratulations! You successfully generated the *}% +\Msg{* seqsplit package. *}% +\Msg{* *}% +\Msg{* Please move the file seqsplit.sty the place where *}% +\Msg{* LaTeX files are kept in your system. The manual *}% +\Msg{* for the package is in the file seqsplit.pdf. *}% +\Msg{* *}% +\Msg{* The package is released under LPPL *}% +\Msg{* *}% +\Msg{* Happy TeXing! *}% +\Msg{*****************************************************}%
\ No newline at end of file diff --git a/Master/texmf-dist/tex/latex/seqsplit/seqsplit.sty b/Master/texmf-dist/tex/latex/seqsplit/seqsplit.sty new file mode 100644 index 00000000000..995f640068d --- /dev/null +++ b/Master/texmf-dist/tex/latex/seqsplit/seqsplit.sty @@ -0,0 +1,41 @@ +%% +%% This is file `seqsplit.sty', +%% generated with the docstrip utility. +%% +%% The original source files were: +%% +%% seqsplit.dtx (with options: `style') +%% +%% IMPORTANT NOTICE: +%% +%% For the copyright see the source file. +%% +%% Any modified versions of this file must be renamed +%% with new filenames distinct from seqsplit.sty. +%% +%% For distribution of the original source see the terms +%% for copying and modification in the file seqsplit.dtx. +%% +%% This generated file may be distributed as long as the +%% original source files, as listed above, are part of the +%% same distribution. (The sources need not necessarily be +%% in the same archive or directory.) +\NeedsTeXFormat{LaTeX2e} +\ProvidesPackage{seqsplit} +[2006/08/07 v0.1 Splitting long sequences (DNA, RNA, proteins, etc.) ] +\def\seqinsert{\ifmmode\allowbreak\else\hspace{0pt plus 0.02em}\fi} +\def\seqsplit#1{\SQSPL@scan#1\SQSPL@end} +\def\SQSPL@scan{\futurelet\SQSPL@next\SQSPL@scani} +\def\SQSPL@scani#1{% + \ifx \SQSPL@end \SQSPL@next \def\SQSPL@process{\@gobble}% + \else \def\SQSPL@process{\SQSPL@doprocess}\fi% + \SQSPL@process{#1}} +\def\SQSPL@doprocess#1{#1\SQSPL@insert} +\def\SQSPL@insert{\futurelet\SQSPL@next\SQSPL@doinsert} +\def\SQSPL@doinsert{% + \ifx \SQSPL@end \SQSPL@next \relax% + \else \seqinsert \fi% + \SQSPL@scan} +\endinput +%% +%% End of file `seqsplit.sty'. diff --git a/Master/texmf-dist/tpm/seqsplit.tpm b/Master/texmf-dist/tpm/seqsplit.tpm new file mode 100644 index 00000000000..6269e751ce6 --- /dev/null +++ b/Master/texmf-dist/tpm/seqsplit.tpm @@ -0,0 +1,30 @@ +<!DOCTYPE rdf:RDF SYSTEM "../../support/tpm.dtd"> +<rdf:RDF xmlns:rdf="http://www.w3.org/1999/02/22-rdf-syntax-ns#" xmlns:TPM="http://texlive.dante.de/"> + <rdf:Description about="http://texlive.dante.de/texlive/Package/seqsplit.zip"> + <TPM:Name>seqsplit</TPM:Name> + <TPM:Type>Package</TPM:Type> + <TPM:Date>2006/08/07 23:02:00</TPM:Date> + <TPM:Version></TPM:Version> + <TPM:Creator>karl</TPM:Creator> + <TPM:Title>The seqsplit package.</TPM:Title> + <TPM:Description></TPM:Description> + <TPM:Author></TPM:Author> + <TPM:Size>147029</TPM:Size> + <TPM:Build/> + <TPM:RunFiles size="2421"> +texmf-dist/tex/latex/seqsplit/seqsplit.sty +texmf-dist/tpm/seqsplit.tpm + </TPM:RunFiles> + <TPM:DocFiles size="128740"> +texmf-dist/doc/latex/seqsplit/README +texmf-dist/doc/latex/seqsplit/seqsplit.pdf + </TPM:DocFiles> + <TPM:SourceFiles size="16943"> +texmf-dist/source/latex/seqsplit/Makefile +texmf-dist/source/latex/seqsplit/seqsplit.dtx +texmf-dist/source/latex/seqsplit/seqsplit.ins + </TPM:SourceFiles> + <TPM:Provides>Package/seqsplit</TPM:Provides> + </rdf:Description> +</rdf:RDF> + diff --git a/Master/texmf/lists/seqsplit b/Master/texmf/lists/seqsplit new file mode 100644 index 00000000000..440e40316f5 --- /dev/null +++ b/Master/texmf/lists/seqsplit @@ -0,0 +1,9 @@ +texmf-dist/doc/latex/seqsplit/README +texmf-dist/doc/latex/seqsplit/seqsplit.pdf +texmf-dist/source/latex/seqsplit/Makefile +texmf-dist/source/latex/seqsplit/seqsplit.dtx +texmf-dist/source/latex/seqsplit/seqsplit.ins +texmf-dist/tex/latex/seqsplit/seqsplit.sty +texmf-dist/tpm/seqsplit.tpm + +texmf/lists/seqsplit diff --git a/Master/texmf/tpm/collection-latexextra.tpm b/Master/texmf/tpm/collection-latexextra.tpm index 39289e07385..5670622afcc 100644 --- a/Master/texmf/tpm/collection-latexextra.tpm +++ b/Master/texmf/tpm/collection-latexextra.tpm @@ -407,6 +407,7 @@ A large collection of add-on packages for LaTeX. <TPM:Package name="sectsty"/> <TPM:Package name="semantic"/> <TPM:Package name="semioneside"/> + <TPM:Package name="seqsplit"/> <TPM:Package name="sf298"/> <TPM:Package name="sffms"/> <TPM:Package name="shadbox"/> |